OdK2
OdK2 is a toxin found in the venom of the Iranian scorpion ''Odonthobuthus doriae''. It belongs to the α-KTx family, and selectively blocks the voltage-gated potassium channel Kv1.3 (KCNA3). Etymology ''Odonthobuthus doriae'' is a scorpion species that belongs to the Buthidae family, mainly found in central and southern Iran. OdK2 is an acronym indicating the toxins originating species, the type of ion channel it targets and the chronological order of its discovery. OdK1 was the first toxin isolated from the same species’ venom, targeting the Kv1.2 channel (KCNA2). Chemistry OdK2 is a relatively small peptide with 38 amino acids and a monoisotopic mass of 4079.869 Da (C167H278N54O49S8). According to the unified nomenclature for short-chain peptides isolated from scorpion venoms, Odk2 can be classified in the second α-KTx family, selectively blocking voltage-gated potassium channels. OdK2 is further classified as α-KTx 3.11 as it presents significant sequence homol ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
KCNA3
Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the ''KCNA3'' gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes – shaker, shaw, shab, and shal – have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Odontobuthus Doriae
''Odontobuthus doriae'', the Yellow Iranian scorpion, is a species of scorpions belonging to the family Buthidae. Description ''Odontobuthus doriae'' can reach a length of about . These medium-sized scorpions show a basic coloration ranging from yellow to pale yellow.Wilson R. LOURENÇO & Adeline PÉZIE Taxonomic consideration of the genus Odontobuthus Vachon (Scorpiones, Buthidae), with description of a new speciesRevue suisse de Zoologie 109 (1): 1 15-125; mars 2002 Distribution This species can be found in Iran and Iraq Iraq,; ku, عێراق, translit=Êraq officially the Republic of Iraq, '; ku, کۆماری عێراق, translit=Komarî Êraq is a country in Western Asia. It is bordered by Turkey to Iraq–Turkey border, the north, Iran to Iran–Iraq .... See also * OdK2, a potassium channel blocker present in the venom of ''Odontobuthus doriae.'' References * Thorell, 1876 : Études scorpiologiques. Atti della Società italiana di scienze naturali Geno ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
P0C909 (KAX3B ODODO)
P, or p, is the sixteenth letter of the Latin alphabet, used in the modern English alphabet, the alphabets of other western European languages and others worldwide. Its name in English is ''pee'' (pronounced ), plural ''pees''. History The Semitic Pê (mouth), as well as the Greek Π or π ( Pi), and the Etruscan and Latin letters that developed from the former alphabet, all symbolized , a voiceless bilabial plosive. Use in writing systems In English orthography and most other European languages, represents the sound . A common digraph in English is , which represents the sound , and can be used to transliterate ''phi'' in loanwords from Greek. In German, the digraph is common, representing a labial affricate . Most English words beginning with are of foreign origin, primarily French, Latin and Greek; these languages preserve Proto-Indo-European initial *p. Native English cognates of such words often start with , since English is a Germanic language and thus ha ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Buthidae
The Buthidae are the largest family of scorpions, containing about 100 genera and 1339 species as of 2022. A few very large genera ('' Ananteris'', '' Centruroides'', ''Compsobuthus'', or '' Tityus'') are known, but a high number of species-poor or monotypic ones also exist. New taxa are being described at a rate of several new species per year. They have a osmopolitandistribution throughout tropical and subtropical environments worldwide. Together with four other families, the Buthidae make up the superfamily Buthoidea. The family was established by Carl Ludwig Koch in 1837. Around 20 species of medically important (meaning potentially lethal to humans) scorpions are known, and all but one of these (''Hemiscorpius lepturus'') are members of the Buthidae. In dead specimens, the spine beneath the stinger, characteristic for this family, can be observed. List of genera and number of species The following genera are recognised in the family Buthidae: * '' Aegaeobuthus'' Kovar ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
KCNA2
Potassium voltage-gated channel subfamily A member 2 also known as Kv1.2 is a protein that in humans is encoded by the ''KCNA2'' gene. Function Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of thi ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Monoisotopic Mass
Monoisotopic mass (Mmi) is one of several types of molecular masses used in mass spectrometry. The theoretical monoisotopic mass of a molecule is computed by taking the sum of the accurate masses (including mass defect) of the most abundant naturally occurring stable isotope of each atom in the molecule. For small molecules made up of low atomic number elements the monoisotopic mass is observable as an isotopically pure peak in a mass spectrum. This differs from the nominal molecular mass, which is the sum of the mass number of the primary isotope of each atom in the molecule and is an integer. It also is different from the molar mass, which is a type of average mass. For some atoms like carbon, oxygen, hydrogen, nitrogen, and sulfur the Mmi of these elements is exactly the same as the mass of its natural isotope, which is the lightest one. However, this does not hold true for all atoms. Iron's most common isotope has a mass number of 56, while the stable isotopes of iron vary in ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
P0C909 (KAX3B ODODO) Disulphide Bridges
P, or p, is the sixteenth letter of the Latin alphabet, used in the modern English alphabet, the alphabets of other western European languages and others worldwide. Its name in English is ''pee'' (pronounced ), plural ''pees''. History The Semitic Pê (mouth), as well as the Greek Π or π ( Pi), and the Etruscan and Latin letters that developed from the former alphabet, all symbolized , a voiceless bilabial plosive. Use in writing systems In English orthography and most other European languages, represents the sound . A common digraph in English is , which represents the sound , and can be used to transliterate ''phi'' in loanwords from Greek. In German, the digraph is common, representing a labial affricate . Most English words beginning with are of foreign origin, primarily French, Latin and Greek; these languages preserve Proto-Indo-European initial *p. Native English cognates of such words often start with , since English is a Germanic language and thus h ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Agitoxin
Agitoxin is a toxin found in the venom of the scorpion '' Leiurus quinquestriatus hebraeus'' (yellow scorpion). Other toxins found in this species include charybdotoxin (CTX). CTX is a close homologue of Agitoxin. Structure Agitoxin can be purified using HPLC techniques. Primary structure: Three types of agitoxin can be distinguished, each identified as comprising 38 amino acids. They are highly homologous, differing only in the identity of the residues at positions 7, 15, 29 and 31. *Agitoxin-1 Gly-Val-Pro-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK, molecular weight = 4014.87 Da, molecular formula = C169H278N52O47S7) *Agitoxin-2 Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Kaliotoxin
{, style="float: right; clear: right; margin: 0 0 0.5em 1em; background: #ffffff;" class="toccolours" border="0" cellpadding="1" align="right" width="280" !The amino acid sequence of Kaliotoxin , - , bgcolor="#eeeeee" , N - Gly - Val - Glu - Ile - Asn - Val - Lys - Cys - Ser - Gly - Ser - Pro - Gln - Cys - Leu - Lys - Pro - Cys - Lys - Asp - Ala - Gly - Met - Arg - Phe - Gly - Lys - Cys - Met - Asn - Arg - Lys - Cys - His - Cys - Thr - Pro - Lys - OH , - Kaliotoxin (KTX) inhibits potassium flux through the Kv1.3 voltage-gated potassium channel and calcium-activated potassium channels by physically blocking the channel-entrance and inducing a conformational change in the K+-Potassium_channel#Selectivity_filter, selectivity filter of the channel. Sources KTX is a neurotoxin derived from the scorpion Androctonus, Androctonus mauretanicus mauretanicus, which is found in the Middle East and North Africa. (Crest M et al.) Chemistry Kaliotoxin is a 4-kDa polypeptide chain, containing ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
IC50
The half maximal inhibitory concentration (IC50) is a measure of the potency of a substance in inhibiting a specific biological or biochemical function. IC50 is a quantitative measure that indicates how much of a particular inhibitory substance (e.g. drug) is needed to inhibit, ''in vitro'', a given biological process or biological component by 50%. The biological component could be an enzyme, cell, cell receptor or microorganism. IC50 values are typically expressed as molar concentration. IC50 is commonly used as a measure of antagonist drug potency in pharmacological research. IC50 is comparable to other measures of potency, such as EC50 for excitatory drugs. EC50 represents the dose or plasma concentration required for obtaining 50% of a maximum effect ''in vivo''. IC50 can be determined with functional assays or with competition binding assays. Sometimes, IC50 values are converted to the pIC50 scale. :\ce = -\log_ \ce Due to the minus sign, higher values of pIC50 ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Cell Proliferation
Cell proliferation is the process by which ''a cell grows and divides to produce two daughter cells''. Cell proliferation leads to an exponential increase in cell number and is therefore a rapid mechanism of tissue growth. Cell proliferation requires both cell growth and cell division to occur at the same time, such that the average size of cells remains constant in the population. Cell division can occur without cell growth, producing many progressively smaller cells (as in cleavage of the zygote), while cell growth can occur without cell division to produce a single larger cell (as in growth of neurons). Thus, cell proliferation is not synonymous with either cell growth or cell division, despite the fact that these terms are sometimes used interchangeably. Stem cells undergo cell proliferation to produce proliferating "transit amplifying" daughter cells that later differentiate to construct tissues during normal development and tissue growth, during tissue regeneratio ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |