Bulevirtide, sold under the brand name Hepcludex, is an
antiviral medication
Antiviral drugs are a class of medication used for treating viral infections. Most antivirals target specific viruses, while a broad-spectrum antiviral is effective against a wide range of viruses. Unlike most antibiotics, antiviral drugs d ...
for the treatment of chronic
hepatitis D
Hepatitis D is a type of viral hepatitis caused by the hepatitis delta virus (HDV). HDV is one of five known hepatitis viruses: A, B, C, D, and E. HDV is considered to be a satellite (a type of subviral agent) because it can propagate only i ...
(in the presence of
hepatitis B
Hepatitis B is an infectious disease caused by the '' Hepatitis B virus'' (HBV) that affects the liver; it is a type of viral hepatitis. It can cause both acute and chronic infection.
Many people have no symptoms during an initial infection. F ...
).
The most common side effects include raised levels of bile salts in the blood and reactions at the site of injection.
Bulevirtide works by attaching to and blocking a receptor (target) through which the hepatitis delta and hepatitis B viruses enter liver cells.
By blocking the entry of the virus into the cells, it limits the ability of HDV to replicate and its effects in the body, reducing symptoms of the disease.
Bulevirtide was approved for medical use in the European Union in July 2020.
Structural formula
Bulevirtide is a 47-amino acid peptide with the following sequence:
CH3(CH2)12CO-
Gly
Glycine (symbol Gly or G; ) is an amino acid that has a single hydrogen atom as its side chain. It is the simplest stable amino acid (carbamic acid is unstable), with the chemical formula NH2‐ CH2‐ COOH. Glycine is one of the proteinogeni ...
-
Thr-
Asn-
Leu-
Ser
Ser or SER may refer to:
Places
* Ser, a village in Bogdand Commune, Satu Mare County, Romania
* Serpens (Ser), an astronomical constellation of the northern hemisphere
* Serres, known as Ser in Serbian, a city in Macedonia, Greece
Organizatio ...
-
Val
Val may refer to: Val-a
Film
* ''Val'' (film), an American documentary about Val Kilmer, directed by Leo Scott and Ting Poo
Military equipment
* Aichi D3A, a Japanese World War II dive bomber codenamed "Val" by the Allies
* AS Val, a Sov ...
-
Pro
Pro is an abbreviation meaning " professional".
Pro, PRO or variants thereof may also refer to:
People
* Miguel Pro (1891–1927), Mexican priest
* Pro Hart (1928–2006), Australian painter
* Mlungisi Mdluli (born 1980), South African retired ...
-Asn-Pro-Leu-Gly-
Phe-Phe-Pro-
Asp
Asp may refer to:
Places
* Asp, part of Densbüren, Aargau, Switzerland
* Aspe (''Asp'' in Valencian), Alicante, Spain
* Asp Lake, a lake in Minnesota
Animals
* Asp (fish)
* Asp (snake), in antiquity, one of several venomous snakes
** ''Cera ...
-
His
His or HIS may refer to:
Computing
* Hightech Information System, a Hong Kong graphics card company
* Honeywell Information Systems
* Hybrid intelligent system
* Microsoft Host Integration Server
Education
* Hangzhou International School, in ...
-
Gln
Glutamine (symbol Gln or Q) is an α-amino acid that is used in the biosynthesis of proteins. Its side chain is similar to that of glutamic acid, except the carboxylic acid group is replaced by an amide. It is classified as a charge-neutra ...
-Leu-Asp-Pro-
Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-
Trp-Asp-Phe-Asn-Pro-Asn-
Lys-Asp-His-Trp-Pro-
Glu-Ala-Asn-Lys-Val-Gly-
NH2 (C
13H
27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH
2)
Medical uses
Bulevirtide is indicated for the treatment of chronic hepatitis delta virus (HDV) infection in plasma (or serum) HDV-RNA positive adult patients with compensated
liver disease
Liver disease, or hepatic disease, is any of many diseases of the liver. If long-lasting it is termed chronic liver disease. Although the diseases differ in detail, liver diseases often have features in common.
Signs and symptoms
Some of the s ...
.
[ Text was copied from this source which is © European Medicines Agency. Reproduction is authorized provided the source is acknowledged.]
Pharmacology
Mechanism of action
Bulevirtide binds and inactivates the
sodium/bile acid cotransporter
Sodium/bile acid cotransporter also known as the Na+-taurocholate cotransporting polypeptide (NTCP) or liver bile acid transporter (LBAT) is a protein that in humans is encoded by the ''SLC10A1'' (solute carrier family 10 member 1) gene.
Struct ...
, blocking both viruses from entering
hepatocyte
A hepatocyte is a cell of the main parenchymal tissue of the liver. Hepatocytes make up 80% of the liver's mass.
These cells are involved in:
* Protein synthesis
* Protein storage
* Transformation of carbohydrates
* Synthesis of cholesterol, ...
s.
The
hepatitis B virus
''Hepatitis B virus'' (HBV) is a partially double-stranded DNA virus, a species of the genus '' Orthohepadnavirus'' and a member of the '' Hepadnaviridae'' family of viruses. This virus causes the disease hepatitis B.
Disease
Despite there b ...
uses its surface
lipopeptide
A lipopeptide is a molecule consisting of a lipid connected to a peptide. They are able to self-assemble into different structures. Many bacteria produced these molecules as a part of their metabolism, especially those of the genus '' Bacillus'', ...
pre-S1 for docking to mature
liver cell
A hepatocyte is a cell of the main parenchymal tissue of the liver. Hepatocytes make up 80% of the liver's mass.
These cells are involved in:
* Protein synthesis
* Protein storage
* Transformation of carbohydrates
* Synthesis of cholesterol, ...
s via their sodium/bile acid cotransporter (NTCP) and subsequently entering the cells. Myrcludex B is a synthetic N-
acyl
In chemistry, an acyl group is a moiety derived by the removal of one or more hydroxyl groups from an oxoacid, including inorganic acids. It contains a double-bonded oxygen atom and an alkyl group (). In organic chemistry, the acyl group ( I ...
ated pre-S1
that can also dock to NTCP, blocking the virus's entry mechanism.
The drug is also effective against hepatitis D because the hepatitis D virus is only effective in the presence of a hepatitis B virus infection.
References
External links
*
Anti–RNA virus drugs
Viral hepatitis
Orphan drugs
Entry inhibitors
{{antiinfective-drug-stub