|
Petrelintide
Petrelintide (development name ZP8396) is an amylin analogue dosed once weekly, developed by Zealand Pharma for the treatment of type 2 diabetes and obesity. Preclinical data suggests it may be more effective in combination with semaglutide. In June 2024 the company announced results for a Phase 1b trial, which found 8.6 percent weight loss over 16 weeks. In March 2025, Roche entered into an exclusive collaboration and licensing agreement with Zealand Pharma to co-develop and co-commercialise petrelintide as a potential foundational therapy for overweight and obese people. This development would focus on petrelintide, both as a standalone therapy and in a fixed-dose combination with CT-388 CT-388 is a "biased" dual GLP-1 and GIP receptor agonist/modulator with minimal to no beta-arrestin coupling at either receptor and is designed to be administered as once weekly subcutaneous injection. In a 24-week trial participants averaged 18.8 ... for overweight and obese people. Refer ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Amylin
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREP ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Zealand Pharma
Zealand Pharma A/S is a Danish biotechnology research company, which designs and develops peptide-based medicines, mainly focusing on metabolic diseases like diabetes and obesity. The company's head office is situated in Søborg near Copenhagen, and it has close to 200 employees. In 2018, they opened a subsidiary in the US. Zealand Pharma forms part of the Danish- Swedish life science cluster Medicon Valley. History Zealand Pharma A/S was founded by Bjarne Due Larsen, Lars Hellerung Christiansen, Leif Helth Jensen, Dan Buxbom, and Florian Schönharting in 1997 as Peptide Probe Technologies ApS, a biopharmaceutical company focused on the design and development of peptide-based medicine. In 1998, the company changed its name to Zealand Pharma ApS following the addition of several new members, including Eva Steiness and former Lundbeck personnel. Eva Steiness was appointed CEO when the company was restructured into a stock corporation, Zealand Pharma A/S, in the spring of 1999 ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Semaglutide
Semaglutide is an anti-diabetic medication used for the treatment of type2 diabetes and an anti-obesity medication used for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered by subcutaneous injection or taken orally. It is sold by Novo Nordisk under the brand names Ozempic and Rybelsus for diabetes, and under the brand name Wegovy for weight management and weight loss. Semaglutide is a glucagon-like peptide-1 receptor agonist. The most common side effects include nausea, vomiting, diarrhea, abdominal pain, and constipation. It was approved for medical use in the US in 2017. In 2022, it was the 48th most commonly prescribed medication in the United States, with more than 13million prescriptions. Medical uses In the US, semaglutide is indicated as an adjunct to diet and exercise to improve glycemic control in adults with type2 diabetes; and to reduce the risk of major a ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
CT-388
CT-388 is a "biased" dual GLP-1 and GIP receptor agonist/modulator with minimal to no beta-arrestin coupling at either receptor and is designed to be administered as once weekly subcutaneous injection. In a 24-week trial participants averaged 18.8 percent placebo adjusted weight loss. The drug is developed by Roche/Genentech Genentech, Inc. is an American biotechnology corporation headquartered in South San Francisco, California. It operates as an independent subsidiary of holding company Roche. Genentech Research and Early Development operates as an independent cent .... References {{reflist GLP-1 receptor agonists GIP receptor agonists ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Reuters
Reuters ( ) is a news agency owned by Thomson Reuters. It employs around 2,500 journalists and 600 photojournalists in about 200 locations worldwide writing in 16 languages. Reuters is one of the largest news agencies in the world. The agency was established in London in 1851 by Paul Reuter. The Thomson Corporation of Canada acquired the agency in a 2008 corporate merger, resulting in the formation of the Thomson Reuters Corporation. In December 2024, Reuters was ranked as the 27th most visited news site in the world, with over 105 million monthly readers. History 19th century Paul Julius Reuter worked at a book-publishing firm in Berlin and was involved in distributing radical pamphlets at the beginning of the Revolutions of 1848. These publications brought much attention to Reuter, who in 1850 developed a prototype news service in Aachen using homing pigeons and electric telegraphy from 1851 on, in order to transmit messages between Brussels and Aachen, in what today is Aa ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Amylin Receptor Agonists
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLN ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
