|
Insulin Pump
An insulin pump is a medical device used for the administration of insulin in the treatment of diabetes mellitus, also known as continuous Subcutaneous tissue, subcutaneous insulin therapy. The device configuration may vary depending on design. A traditional pump includes: * the pump (including controls, processing module, and batteries) * a disposable reservoir for insulin (inside the pump) * a disposable infusion set, including a cannula for subcutaneous insertion (under the skin) and a tubing system to connect the insulin reservoir to the cannula. Other configurations are possible. More recent models may include disposable or semi-disposable designs for the pumping mechanism and may eliminate tubing from the infusion set. An insulin pump is an alternative to multiple daily injections of insulin by syringe#Standard U-100 insulin syringes, insulin syringes or an insulin pen and allows for flexible insulin therapy when used in conjunction with blood glucose monitoring and ca ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Insulin Pump With Infusion Set
Insulin (, from Latin ''insula'', 'island') is a peptide hormone produced by beta cells of the pancreatic islets encoded in humans by the insulin (''INS)'' gene. It is the main Anabolism, anabolic hormone of the body. It regulates the metabolism of carbohydrates, fats, and protein by promoting the absorption of glucose from the blood into cells of the liver, fat cell, fat, and skeletal muscles. In these tissues the absorbed glucose is converted into either glycogen, via glycogenesis, or Fatty acid metabolism#Glycolytic end products are used in the conversion of carbohydrates into fatty acids, fats (triglycerides), via lipogenesis; in the liver, glucose is converted into both. Glucose production and secretion by the liver are strongly inhibited by high concentrations of insulin in the blood. Circulating insulin also affects the synthesis of proteins in a wide variety of tissues. It is thus an anabolic hormone, promoting the conversion of small molecules in the blood into large ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Diabetic Neuropathy
Diabetic neuropathy includes various types of nerve damage associated with diabetes mellitus. The most common form, diabetic peripheral neuropathy, affects 30% of all diabetic patients. Studies suggests that cutaneous nerve branches, such as the sural nerve, are involved in more than half of patients with diabetes 10 years after the diagnosis and can be detected with high-resolution magnetic resonance imaging. Symptoms depend on the site of nerve damage and can include motor changes such as weakness; sensory symptoms such as numbness, tingling, or pain; or autonomic changes such as urinary symptoms. These changes are thought to result from a microvascular disease, microvascular injury involving small blood vessels that supply nerves (vasa nervorum). Relatively common conditions which may be associated with diabetic neuropathy include distal symmetric polyneuropathy; Oculomotor nerve palsy, third, Fourth nerve palsy, fourth, or Sixth nerve palsy, sixth cranial nerve palsy; mononeuro ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Amylin
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREP ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Artificial Pancreas
Automated insulin delivery systems are automated (or semi-automated) systems designed to assist people with insulin-requiring diabetes, by automatically adjusting insulin delivery in response to blood glucose levels. Currently available systems (as of October 2020) can only deliver (and regulate delivery of) a single hormone—insulin. Other systems currently in development aim to improve on current systems by adding one or more additional hormones that can be delivered as needed, providing something closer to the endocrine functionality of the pancreas. The endocrine functionality of the pancreas is provided by islet cells which produce the hormones insulin and glucagon. Artificial pancreatic technology mimics the secretion of these hormones into the bloodstream in response to the body's changing blood glucose levels. Maintaining balanced blood sugar levels is crucial to the function of the brain, liver, and kidneys. Therefore, for people with diabetes, it is necessary that t ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Radio Frequency
Radio frequency (RF) is the oscillation rate of an alternating electric current or voltage or of a magnetic, electric or electromagnetic field or mechanical system in the frequency range from around to around . This is roughly between the upper limit of audio frequencies that humans can hear (though these are not electromagnetic) and the lower limit of infrared frequencies, and also encompasses the microwave range. These are the frequencies at which energy from an oscillating current can radiate off a conductor into space as radio waves, so they are used in radio technology, among other uses. Different sources specify different upper and lower bounds for the frequency range. Electric current Electric currents that oscillate at radio frequencies (RF currents) have special properties not shared by direct current or lower audio frequency alternating current, such as the 50 or 60 Hz current used in electrical power distribution. * Energy from RF currents in conduct ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Diabetes Management Software
Diabetes Management Software refers to software tools that run on personal computers and personal digital assistants to help persons with Type 1 and Type 2 diabetes manage the data associated with: * blood test results from a glucose meter * diabetes logbooks * basal and bolus settings for an insulin pump * records of actual insulin delivery * records of carbohydrates eaten and bloused to cover * statistical evaluation * manual log entries for exercise and other factors * coaching of dose corrections * prediction of future blood sugars, etc. Features and uses Conducting regular self-management tasks such as medication and insulin intake, blood sugar checkup, diet observance, and physical exercise are really demanding. This is why the use of diabetes-related apps for the purposes of recording diet and medication intake or blood glucose level is promising to improve the health condition for the patients. There are many products available to help maintain records and analyze tr ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
National Institute For Health And Care Excellence
The National Institute for Health and Care Excellence (NICE) is an executive non-departmental public body of the Department of Health and Social Care (United Kingdom), Department of Health and Social Care. As the national health technology assessment body of England, it is responsible for judging the cost-effectiveness of medicines and making them available on the NHS through reimbursement, with its judgements informing decisions in Wales and Northern Ireland. It also provides a range of clinical guidance to the NHS in England and Wales, which are considered by Northern Ireland. History Organisational history It was set up as the National Institute for Clinical Excellence in 1999, and on 1 April 2005 joined with the Health Development Agency to become the new National Institute for Health and Clinical Excellence (still abbreviated as NICE). Following the Health and Social Care Act 2012, NICE was renamed the National Institute for Health and Care Excellence on 1 April ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Bristol Royal Infirmary
The Bristol Royal Infirmary (BRI) is a large teaching hospital in the centre of Bristol, England. It has links with the nearby University of Bristol and the Faculty of Health and Social Care at the University of the West of England, also in Bristol. The BRI is one of nine hospitals operated by the University Hospitals Bristol and Weston NHS Foundation Trust. It is on the same site as the Bristol Royal Hospital for Children, Bristol Haematology and Oncology Centre, and Bristol Heart Institute (BHI). The Bristol Haematology and Oncology Centre has 49 beds and the Bristol Heart Institute has 107, which are not included in the main hospital's total. History Early history The Bristol Royal Infirmary was founded by public subscription in 1735, making it one of the oldest infirmaries in the United Kingdom. The infirmary was opened on Maudlin Lane (now Lower Maudlin Street) in December 1737, taking 17 male and 17 female patients. In 1904, Sir George White, who gave Bristol its ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Guy's Hospital
Guy's Hospital is an NHS hospital founded by philanthropist Thomas Guy in 1721, located in the borough of Southwark in central London. It is part of Guy's and St Thomas' NHS Foundation Trust and one of the institutions that comprise the King's Health Partners, an academic health science centre. It is the large teaching hospital of GKT School of Medical Education. The hospital's Tower Wing (originally known as Guy's Tower) was, when built in 1974, the tallest hospital building in the world, standing at with 34 floors. The tower was overtaken as the world's tallest healthcare-related building by The Belaire in New York City in 1988. As of June 2019, the Tower Wing, which remains one of the tallest buildings in London, is the world's sixth-tallest hospital building. History The hospital dates from 1721, when it was founded by philanthropist Thomas Guy, who had made a fortune as a printer of Bibles and greatly increased it by speculating in the South Sea Bubble. It was o ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Robert Channon
Robert Derek Channon (born 15 June 1944) is a British engineer known for inventing an insulin pump for diabetics, and miniaturized helicopters for the UK military. A diabetic himself, Channon developed the three ounce insulin pump to replace his own regular insulin injections. The National Medical Research Foundation awarded Channon £26,000 to develop the pump. In 1980, the National Medical Research Foundation awarded Guy's Hospital £40,000 to test Channon's pump in people with diabetes. The trial, under the supervision of Harry Keen, tested whether using the pump reduced the development of blindness in 30 people with diabetes. In July 2024 Channon was awarded an honorary Doctor of Engineering degree, by University of the West of England, UWE Bristol, in recognition of his contribution to the management of type 1 diabetes. The insulin infusion pump and related inventions In 1978 Channon was referred to Professor Harry Keen, a diabetes specialist at Guy's Hospital, who took ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Loma Linda University
Loma Linda University (LLU) is a private Seventh-day Adventist health sciences university in Loma Linda, California. , the university comprises eight schools and a Faculty of Graduate Studies. It is a part of the Seventh-day Adventist education system. The university is accredited by the WASC Senior College and University Commission (WSCUC). Its on-campus church has around 7,000 members. History Beginnings Loma Linda University had its beginning in 1905 when Seventh-day Adventists John Burden and Ellen G. White founded what became known as the Loma Linda Sanitarium. In February 1906, a council of church workers met at Loma Linda. It consisted of the faculty of Fernando Academy, the faculty of the Loma Linda school, and the executive committee of the Southern California Conference. In 1906, The Loma Linda College of Evangelists was established. Courses included: * Religion: Bible Evangelism, Acts and Epistles, Missionary Methods, and Doctrines and Prophecies * General: ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Intensive Insulin Therapy
Intensive insulin therapy or flexible insulin therapy is a therapeutic regimen for diabetes mellitus treatment. This newer approach contrasts with conventional insulin therapy. Rather than minimize the number of insulin injections per day (a technique which demands a rigid schedule for food and activities), the intensive approach favors flexible meal times with variable carbohydrate as well as flexible physical activities. The trade-off is the increase from 2 or 3 injections per day to 4 or more injections per day, which was considered "intensive" relative to the older approach. In North America in 2004, many endocrinologists prefer the term "flexible insulin therapy" (FIT) to "intensive therapy" and use it to refer to any method of replacing insulin that attempts to mimic the pattern of small continuous basal insulin secretion of a working pancreas combined with larger insulin secretions at mealtimes. The semantic distinction reflects changing treatment. Rationale Long-term st ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
