Daniel J. Drucker
Daniel Joshua Drucker (born 23 June 1956) is a Canadian endocrinologist. A Fellow of the Royal Society, he is a professor of medicine at the Lunenfeld-Tanenbaum Research Institute, Mount Sinai Hospital, Toronto. He is known for his research into intestinal hormones and their use in the treatment of diabetes and other metabolic diseases. Early life and education Drucker was born and grew up in Montreal, and then enrolled in the University of Ottawa."This Toronto doctor is a superstar in the world of diabetes research — and he says it all started as a fluke" ''Toronto Star'', By Joseph Hall, 7 February 2020 After graduation he move ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Royal Society
The Royal Society, formally The Royal Society of London for Improving Natural Knowledge, is a learned society and the United Kingdom's national academy of sciences. The society fulfils a number of roles: promoting science and its benefits, recognising excellence in science, supporting outstanding science, providing scientific advice for policy, education and public engagement and fostering international and global co-operation. Founded on 28 November 1660, it was granted a royal charter by King Charles II as The Royal Society and is the oldest continuously existing scientific academy in the world. The society is governed by its Council, which is chaired by the Society's President, according to a set of statutes and standing orders. The members of Council and the President are elected from and by its Fellows, the basic members of the society, who are themselves elected by existing Fellows. , there are about 1,700 fellows, allowed to use the postnominal title FRS ( Fellow of ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
University Of Ottawa
The University of Ottawa (french: Université d'Ottawa), often referred to as uOttawa or U of O, is a bilingual public research university in Ottawa, Ontario, Canada. The main campus is located on directly to the northeast of Downtown Ottawa across the Rideau Canal in the Sandy Hill neighbourhood. The University of Ottawa was first established as the College of Bytown in 1848 by the first bishop of the Catholic Archdiocese of Ottawa, Joseph-Bruno Guigues. Placed under the direction of the Oblates of Mary Immaculate, it was renamed the College of Ottawa in 1861 and received university status five years later through a royal charter. On 5 February 1889, the university was granted a pontifical charter by Pope Leo XIII, elevating the institution to a pontifical university. The university was reorganized on July 1, 1965, as a corporation, independent from any outside body or religious organization. As a result, the civil and pontifical charters were kept by the newly created ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Wolf Prize In Medicine
The Wolf Prize in Medicine is awarded annually by the Wolf Foundation in Israel. It is one of the six Wolf Prizes established by the Foundation and awarded since 1978; the others are in Agriculture, Chemistry, Mathematics, Physics and Arts. The Prize has been stated to be the second most prestigious award in science, and a significant predictor of the Nobel Prize. Laureates Source: Laureates per country Below is a chart of all laureates per country (updated to 2022 laureates). Some laureates are counted more than once if have multiple citizenship. See also * List of medicine awards Notes and references External links * * * Wolf Prizes 2015Jerusalempost Israel-Wolf-Prizes 2016Jerusalempost Israel-Wolf-Prizes 2017Wolf Prize 2019 {{DEFAULTSORT:Wolf Prize In Medicine Medicine awards Medicine Medicine is the science and Praxis (process), practice of caring for a patient, managing the diagnosis, prognosis, Preventive medicine, prevention, therapy, treatment, ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Canada Gairdner International Award
The Canada Gairdner International Award is given annually by the Gairdner Foundation at a special dinner to five individuals for outstanding discoveries or contributions to medical science. Receipt of the Gairdner is traditionally considered a precursor to winning the Nobel Prize in Medicine; as of 2020, 95 Nobel Prizes have been awarded to prior Gairdner recipients. Canada Gairdner International Awards are given annually in the amount of $100,000 (each) payable in Canadian funds and can be awarded to residents of any country in the world. A joint award may be given for the same discovery or contribution to medical science, but in that case each awardee receives a full prize. Past winners *1959 Alfred Blalock, , Harry M. Rose, William D.M. Paton, Eleanor Zaimis, Wilfred G. Bigelow *1960 Joshua Harold Burn, John H. Gibbon Jr., William F. Hamilton, John McMichael, Karl Meyer, Arnold Rice Rich *1961 Russell Brock, Alan C. Burton, Alexander B. Gutman, Jonas H. Kellgren ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
American Diabetes Association
The American Diabetes Association (ADA) is a United States-based nonprofit that seeks to educate the public about diabetes and to help those affected by it through funding research to manage, cure and prevent diabetes (including type 1 diabetes, type 2 diabetes, gestational diabetes, and pre-diabetes). It is a network of 565,000 volunteers which includes 20,000 healthcare professionals and administration staff members. Historical background The ADA was formerly founded in 1939. It was founded by six physicians − including Dr. Herman O. Mosenthal, Dr. Joseph T. Beardwood Jr., Dr. Joseph H. Barach, and Dr. E. S. Dillion − at their annual meeting of the American College of Physicians. Each year the ADA hosts Scientific Sessions, a meeting for diabetes professionals. The ADA has nearly 20,000 members. In the early 2000s, the ADA struck a three-year, $1.5 million sponsorship deal with Cadbury-Schweppes, the world's largest confectioner products including Diet-Rite sodas, Sna ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
University Of Cambridge
, mottoeng = Literal: From here, light and sacred draughts. Non literal: From this place, we gain enlightenment and precious knowledge. , established = , other_name = The Chancellor, Masters and Scholars of the University of Cambridge , type = Public research university , endowment = £7.121 billion (including colleges) , budget = £2.308 billion (excluding colleges) , chancellor = The Lord Sainsbury of Turville , vice_chancellor = Anthony Freeling , students = 24,450 (2020) , undergrad = 12,850 (2020) , postgrad = 11,600 (2020) , city = Cambridge , country = England , campus_type = , sporting_affiliations = The Sporting Blue , colours = Cambridge Blue , website = , logo = University of Cambridge log ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
European Association For The Study Of Diabetes
The European Association for the Study of Diabetes (EASD) is a scientific association founded in Montecatini Terme, Italy in 1965 with Joseph Hoet as Founding President. The aims of the association are to encourage and support research in the field of diabetes, the rapid diffusion of acquired knowledge in that field, and to facilitate its application. Membership The association is based on individual membership and embraces scientists, physicians, laboratory workers, nurses and students internationally who are interested in diabetes and related subjects. An Active Member is an individual holding a medical degree or a scientific worker with an academic degree who has paid the current annual membership fee. Members are entitled to vote at the general assembly, which is held during the annual meeting, and are eligible for election to the council and to the executive committee. Membership also provides the possibility of attending the annual meetings of the association at a conside ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Claude Bernard
Claude Bernard (; 12 July 1813 – 10 February 1878) was a French physiologist. Historian I. Bernard Cohen of Harvard University called Bernard "one of the greatest of all men of science". He originated the term '' milieu intérieur'', and the associated concept of homeostasis (the latter term being coined by Walter Cannon). Life and career Bernard was born in 1813 in the village of Saint-Julien near Villefranche-sur-Saône. He received his early education in the Jesuit school of that town, and then proceeded to the college at Lyon, which, however, he soon left to become assistant in a druggist's shop. He is sometimes described as an agnostic and even humorously referred to by his colleagues as a "great priest of atheism". Despite this, after his death Cardinal Ferdinand Donnet claimed Bernard was a fervent Catholic, with a biographical entry in the ''Catholic Encyclopedia''. His leisure hours were devoted to the composition of a vaudeville comedy, and the success it achieved ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Endocrine Society
The Endocrine Society is a professional, international medical organization in the field of endocrinology and metabolism, founded in 1916 as The Association for the Study of Internal Secretions. The official name of the organization was changed to the Endocrine Society on January 1, 1952. It is a leading organization in the field and publishes four leading journals. It has more than 18,000 members from over 120 countries in medicine, molecular and cellular biology, biochemistry, physiology, genetics, immunology, education, industry, and allied health. The Society's mission is: "to advance excellence in endocrinology and promote its essential and integrative role in scientific discovery, medical practice, and human health." It is said to be "the world's oldest, largest and most active organization devoted to research on hormones and the clinical practice of endocrinology." Annual Meetings have been held since 1916 except in 1943 and 1945 during World War II when meetings were c ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
University Of Chicago
The University of Chicago (UChicago, Chicago, U of C, or UChi) is a private university, private research university in Chicago, Illinois. Its main campus is located in Chicago's Hyde Park, Chicago, Hyde Park neighborhood. The University of Chicago is consistently ranked among the best universities in the world and it is among the most selective in the United States. The university is composed of College of the University of Chicago, an undergraduate college and five graduate research divisions, which contain all of the university's graduate programs and interdisciplinary committees. Chicago has eight professional schools: the University of Chicago Law School, Law School, the Booth School of Business, the Pritzker School of Medicine, the Crown Family School of Social Work, Policy, and Practice, the Harris School of Public Policy, the University of Chicago Divinity School, Divinity School, the Graham School of Continuing Liberal and Professional Studies, and the Pritzker School of ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Donald F
Donald is a masculine given name derived from the Gaelic name ''Dòmhnall''.. This comes from the Proto-Celtic *''Dumno-ualos'' ("world-ruler" or "world-wielder"). The final -''d'' in ''Donald'' is partly derived from a misinterpretation of the Gaelic pronunciation by English speakers, and partly associated with the spelling of similar-sounding Germanic names, such as ''Ronald''. A short form of ''Donald'' is ''Don''. Pet forms of ''Donald'' include ''Donnie'' and ''Donny''. The feminine given name ''Donella'' is derived from ''Donald''. ''Donald'' has cognates in other Celtic languages: Modern Irish ''Dónal'' (anglicised as ''Donal'' and ''Donall'');. Scottish Gaelic ''Dòmhnall'', ''Domhnull'' and ''Dòmhnull''; Welsh '' Dyfnwal'' and Cumbric ''Dumnagual''. Although the feminine given name ''Donna'' is sometimes used as a feminine form of ''Donald'', the names are not etymologically related. Variations Kings and noblemen Domnall or Domhnall is the name of many ancie ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
GLP-2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |