Blastocrithidia Largi
''Blastocrithidia'' is a genus of parasitic flagellate protist belonging to the family Trypanosomatidae. It is a monoxenous parasite of heteropteran insects, mainly inhabiting their hindgut and glands. Characteristics In addition to ''Blastocrithidia'', one-host trypanosomatids from hemipteran and dipteran insects have been traditionally placed in genera ''Crithidia'', '' Leptomonas'', '' Herpetomonas'', '' Rhynchoidomonas'', and '' Wallaceina''. ''Blastocrithidia'' is characterized by epimastigote morphological forms, whereas opisthomastigotes and endomastigotes are exclusive features of the genera ''Herpetomonas'' and ''Wallaceina'', respectively. ''Blastocrithidia'' is also able to produce resistant cysts. Systematics The etymology of the genus name ''Blastocrithidia'' derives from the two Ancient Greek words (), meaning "sprout, scion, child or descendant", and (), meaning "small grain of barley". The genus includes the following species. * '' Blastocrithidia cal ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Blastocrithidia Familiaris
''Blastocrithidia'' is a genus of parasitic flagellate protist belonging to the family Trypanosomatidae. It is a monoxenous parasite of heteropteran insects, mainly inhabiting their hindgut and glands. Characteristics In addition to ''Blastocrithidia'', one-host trypanosomatids from hemipteran and dipteran insects have been traditionally placed in genera ''Crithidia'', '' Leptomonas'', '' Herpetomonas'', '' Rhynchoidomonas'', and '' Wallaceina''. ''Blastocrithidia'' is characterized by epimastigote morphological forms, whereas opisthomastigotes and endomastigotes are exclusive features of the genera ''Herpetomonas'' and ''Wallaceina'', respectively. ''Blastocrithidia'' is also able to produce resistant cysts. Systematics The etymology of the genus name ''Blastocrithidia'' derives from the two Ancient Greek words (), meaning "sprout, scion, child or descendant", and (), meaning "small grain of barley". The genus includes the following species. * '' Blastocrithidia cal ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Blastocrithidia Nuclear Code
The ''Blastocrithidia'' nuclear code (translation table 31) is a genetic code used by the nuclear genome of the trypanosomatid genus '' Blastocrithidia''. The code (31) : AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = ----------**-----------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine Guanine () (symbol G or Gua) is one of the four main nucleobases found in the nucleic acids DNA and RNA, the others being adenine, cytosine, and thymine ( uracil in RNA). In DNA, guanine is paired with cytosine. The guanine nucleoside is c ... (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Asp ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Stop Codon
In molecular biology (specifically protein biosynthesis), a stop codon (or termination codon) is a codon ( nucleotide triplet within messenger RNA) that signals the termination of the translation process of the current protein. Most codons in messenger RNA correspond to the addition of an amino acid to a growing polypeptide chain, which may ultimately become a protein; stop codons signal the termination of this process by binding release factors, which cause the ribosomal subunits to disassociate, releasing the amino acid chain. While start codons need nearby sequences or initiation factors to start translation, a stop codon alone is sufficient to initiate termination. Properties Standard codons In the standard genetic code, there are three different termination codons: Alternative stop codons There are variations on the standard genetic code, and alternative stop codons have been found in the mitochondrial genomes of vertebrates, '' Scenedesmus obliquus'', and ' ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Genetic Code
The genetic code is the set of rules used by living cells to translate information encoded within genetic material ( DNA or RNA sequences of nucleotide triplets, or codons) into proteins. Translation is accomplished by the ribosome, which links proteinogenic amino acids in an order specified by messenger RNA (mRNA), using transfer RNA (tRNA) molecules to carry amino acids and to read the mRNA three nucleotides at a time. The genetic code is highly similar among all organisms and can be expressed in a simple table with 64 entries. The codons specify which amino acid will be added next during protein biosynthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. The vast majority of genes are encoded with a single scheme (see the RNA codon table). That scheme is often referred to as the canonical or standard genetic code, or simply ''the'' genetic code, though variant codes (such as in mitochondria) exist. History Effo ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Nuclear Genome
Nuclear DNA (nDNA), or nuclear deoxyribonucleic acid, is the DNA contained within each cell nucleus of a eukaryotic organism. It encodes for the majority of the genome in eukaryotes, with mitochondrial DNA and plastid DNA coding for the rest. It adheres to Mendelian inheritance, with information coming from two parents, one male and one female—rather than matrilineally (through the mother) as in mitochondrial DNA. Structure Nuclear DNA is a nucleic acid, a polymeric biomolecule or biopolymer, found in the nucleus of eukaryotic cells. Its structure is a double helix, with two strands wound around each other, a structure first described by Francis Crick and James D. Watson (1953) using data collected by Rosalind Franklin. Each strand is a long polymer chain of repeating nucleotides. Each nucleotide is composed of a five-carbon sugar, a phosphate group, and an organic base. Nucleotides are distinguished by their bases: purines, large bases that include adenine and guanine; and ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Blastocrithidia Nonstop
''Blastocrithidia'' is a genus of parasitic flagellate protist belonging to the family Trypanosomatidae. It is a monoxenous parasite of heteropteran insects, mainly inhabiting their hindgut and glands. Characteristics In addition to ''Blastocrithidia'', one-host trypanosomatids from hemipteran and dipteran insects have been traditionally placed in genera ''Crithidia'', ''Leptomonas'', '' Herpetomonas'', '' Rhynchoidomonas'', and '' Wallaceina''. ''Blastocrithidia'' is characterized by epimastigote morphological forms, whereas opisthomastigotes and endomastigotes are exclusive features of the genera ''Herpetomonas'' and ''Wallaceina'', respectively. ''Blastocrithidia'' is also able to produce resistant cysts. Systematics The etymology of the genus name ''Blastocrithidia'' derives from the two Ancient Greek words (), meaning "sprout, scion, child or descendant", and (), meaning "small grain of barley". The genus includes the following species. * ''Blastocrithidia cali ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Blastocrithidia Papi
''Blastocrithidia'' is a genus of parasitic flagellate protist belonging to the family Trypanosomatidae. It is a monoxenous parasite of heteropteran insects, mainly inhabiting their hindgut and glands. Characteristics In addition to ''Blastocrithidia'', one-host trypanosomatids from hemipteran and dipteran insects have been traditionally placed in genera ''Crithidia'', '' Leptomonas'', '' Herpetomonas'', '' Rhynchoidomonas'', and '' Wallaceina''. ''Blastocrithidia'' is characterized by epimastigote morphological forms, whereas opisthomastigotes and endomastigotes are exclusive features of the genera ''Herpetomonas'' and ''Wallaceina'', respectively. ''Blastocrithidia'' is also able to produce resistant cysts. Systematics The etymology of the genus name ''Blastocrithidia'' derives from the two Ancient Greek words (), meaning "sprout, scion, child or descendant", and (), meaning "small grain of barley". The genus includes the following species. * ''Blastocrithidia cali ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |