|
Scorpion Sting
A scorpion sting is an injury caused by the stinger of a scorpion resulting in the medical condition known as scorpionism, which may vary in severity. The anatomical part of the scorpion that delivers the sting is called a "telson". In typical cases, scorpion stings usually result in pain, paresthesia, and variable swelling. In serious cases, scorpion stings may involve the envenomation of humans by toxic scorpions, which may result in extreme pain, serious illness, or even death depending on the toxicity of the venom. Most scorpion stings range in severity from minor swelling to medically significant lesions, with only a few able to cause severe allergic, neurotic or necrotic reactions. However, scorpion stings account for approximately 3,000 deaths a year worldwide. The Brazilian yellow scorpion (''Tityus serrulatus'') is one species known for being especially dangerous, being responsible for most scorpion sting fatalities in South America. Scorpion stings are seen all over the ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Scorpions
Scorpions are predatory arachnids of the Order (biology), order Scorpiones. They have eight legs and are easily recognized by a pair of Chela (organ), grasping pincers and a narrow, segmented tail, often carried in a characteristic forward curve over the back and always ending with a stinger. The evolutionary history of scorpions goes back Silurian, 435 million years. They mainly live in deserts but have adapted to a wide range of environmental conditions, and can be found on all continents except Antarctica. There are over 2,500 described species, with 22 extant (living) families recognized to date. Their Taxonomy (biology), taxonomy is being revised to account for 21st-century genomic studies. Scorpions primarily prey on insects and other invertebrates, but some species hunt vertebrates. They use their pincers to restrain and kill prey, or to prevent their own predation. The Scorpion sting, venomous sting is used for offense and defense. During courtship, the male and female ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Stinger
A stinger (or sting) is a sharp organ found in various animals (typically insects and other arthropods) capable of injecting venom, usually by piercing the epidermis of another animal. An insect sting is complicated by its introduction of venom, although not all stings are venomous. Bites, which can introduce saliva as well as additional pathogens and diseases, are often confused with stings, and vice versa. Specific components of venom are believed to give rise to an allergic reaction, which in turn produces skin lesions that may vary from a small itching weal, or slightly elevated area of the skin, to large areas of inflamed skin covered by vesicles and crusted lesions. Stinging insects produce a painful swelling of the skin, the severity of the lesion varying according to the location of the sting, the identity of the insect and the sensitivity of the subject. Many species of bees and wasps have two poison glands, one gland secreting a toxin in which formic acid is ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Middle East
The Middle East (term originally coined in English language) is a geopolitical region encompassing the Arabian Peninsula, the Levant, Turkey, Egypt, Iran, and Iraq. The term came into widespread usage by the United Kingdom and western European nations in the early 20th century as a replacement of the term Near East (both were in contrast to the Far East). The term "Middle East" has led to some confusion over its changing definitions. Since the late 20th century, it has been criticized as being too Eurocentrism, Eurocentric. The region includes the vast majority of the territories included in the closely associated definition of West Asia, but without the South Caucasus. It also includes all of Egypt (not just the Sinai Peninsula, Sinai) and all of Turkey (including East Thrace). Most Middle Eastern countries (13 out of 18) are part of the Arab world. The list of Middle Eastern countries by population, most populous countries in the region are Egypt, Turkey, and Iran, whil ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Buthidae
The Buthidae are the largest family of scorpions, containing about 100 genera and 1339 species as of 2022. A few very large genera ('' Ananteris'', '' Centruroides'', '' Compsobuthus'', or '' Tityus'') are known, but a high number of species-poor or monotypic ones also exist. New taxa are being described at a rate of several new species per year. They have a cosmopolitan distribution throughout tropical and subtropical environments worldwide. Together with four other families, the Buthidae make up the superfamily Buthoidea. The family was established by Carl Ludwig Koch in 1837. Around 20 species of medically important (meaning potentially lethal to humans) scorpions are known, and all but one of these ('' Hemiscorpius lepturus'') are members of the Buthidae. In dead specimens, the spine beneath the stinger, characteristic for this family, can be observed. List of genera and number of species The following genera are recognised in the family Buthidae: * '' Aegaeobuthus'' Kovari ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Vasoactive Intestinal Polypeptide
Vasoactive intestinal peptide, also known as vasoactive intestinal polypeptide or VIP, is a peptide hormone that is vasoactive in the intestine. VIP is a peptide of 28 amino acid residue (chemistry), residues that belongs to a Secretin family, glucagon/secretin superfamily, the ligand (biochemistry), ligand of class II G protein–coupled receptors. VIP is produced in many tissues of vertebrates including the Gut (zoology), gut, pancreas, neocortex, and suprachiasmatic nuclei of the hypothalamus in the brain. VIP stimulates contractility in the heart, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of Vertebrate trachea, trachea, stomach and gallbladder. In humans, the vasoactive intestinal peptide is encoded by the ''VIP'' gene. VIP has a half-life (t½) in the blood of about two minutes. Function In the digestive system In the digestive system, VIP seems to induce smooth muscle relaxation (lower esophageal sphincte ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Agitoxin
Agitoxin is a toxin found in the venom of the scorpion '' Leiurus quinquestriatus hebraeus'' (yellow scorpion). Other toxins found in this species include charybdotoxin (CTX). CTX is a close homologue of Agitoxin. Structure Agitoxin can be purified using HPLC techniques. Primary structure: Three types of agitoxin can be distinguished, each identified as comprising 38 amino acids. They are highly homologous, differing only in the identity of the residues at positions 7, 15, 29 and 31. *Agitoxin-1 Gly-Val-Pro-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK, molecular weight = 4014.87 Da, molecular formula = C169H278N52O47S7) *Agitoxin-2 Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Scyllatoxin
Scyllatoxin (also leiurotoxin I) is a toxin, from the scorpion '' Leiurus quinquestriatus hebraeus'', which blocks small-conductance Ca2+-activated K+ channels. It is named after Scylla, a sea monster from Greek mythology. Charybdotoxin is also found in the venom from the same species of scorpion, and is named after the sea monster Charybdis. In Greek mythology, Scylla and Charybdis lived on rocks on opposing sides of a narrow strait of water. Sources Scyllatoxin is one of the components of the venom of the Israeli scorpion ''‘Leiurus quinquestriatus hebraeus’''. It consists of only 0.02% of the total protein in crude venom. Chemistry Leiurotoxin I is a 31-residue peptide (sequence AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2), with a helix and a short antiparallel β-sheet. This toxin is stabilized by disulfide bonds: Cys8-Cys26 and Cys12-Cys28 is bound to the β-sheet, while Cys3-Cys21 is bound to an N-terminal segment preceding the helix. Leiurotoxin adopts the ά/β moti ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Charybdotoxin
Charybdotoxin (ChTX) is a 37 amino acid neurotoxin from the venom of the scorpion '' Leiurus quinquestriatus hebraeus'' (''deathstalker'') that blocks calcium-activated potassium channels. This blockade causes hyperexcitability of the nervous system. It is a close homologue of agitoxin and both toxins come from ''Leiurus quinquestriatus hebraeus''. It is named after Charybdis, a sea monster from Greek myth. Chemical properties Family The Charybdotoxin family of scorpion toxins is a group of small peptides that has many family members, such as the pandinotoxin, derived from the venom of scorpion Pandinus imperator. Structure Scorpions such as the deathstalker paralyze their prey by injecting a potent mix of peptide toxins. Charybdotoxin, a 37 amino acid, 4 kDa neurotoxin with the molecular formula C176H277N57O55S7, is one of the peptide toxins that can be extracted from the venom of the scorpion. Its structure is very similar to that of margatoxin. Charybdotoxin contains thre ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Chlorotoxin
Chlorotoxin is a 36-amino acid peptide found in the venom of the Deathstalker, deathstalker scorpion (''Leiurus quinquestriatus'') which blocks small-conductance chloride channels. The fact that chlorotoxin binds preferentially to glioma cells has allowed the development of methods for the treatment and diagnosis of several types of cancer. Sources Chlorotoxin can be purified from crude leiurus, which belongs to the scorpion toxin protein Superfamily (proteins), superfamily. Chemistry Chlorotoxin is a small toxin and at pH 7 is highly positively charged. It is a peptide consisting of 36 amino acids, with 8 cysteines forming 4 disulfide bonds. Chlorotoxin has a considerable sequence homology to the class of small insect toxin, insectotoxins. Target Chlorotoxin is the first reported high-affinity peptide ligand for Cl− channels and it blocks small conductance chloride channels. Each chloride channel can be closed by only one ligand molecule. Using a recombinant chloroto ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neurotoxin
Neurotoxins are toxins that are destructive to nervous tissue, nerve tissue (causing neurotoxicity). Neurotoxins are an extensive class of exogenous chemical neurological insult (medical), insultsSpencer 2000 that can adversely affect function in both developing and mature nervous tissue.Olney 2002 The term can also be used to classify endogenous compounds, which, when abnormally contacted, can prove neurologically toxic. Though neurotoxins are often neurologically destructive, their ability to specifically target neural components is important in the study of nervous systems. Common examples of neurotoxins include lead, ethanol (drinking alcohol), glutamate,Choi 1987 nitric oxide, botulinum toxin (e.g. Botox), tetanus toxin,Simpson 1986 and tetrodotoxin. Some substances such as nitric oxide and glutamate are in fact essential for proper function of the body and only exert neurotoxic effects at excessive concentrations. Neurotoxins inhibit neuron control over ion concentrations ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Serotonin
Serotonin (), also known as 5-hydroxytryptamine (5-HT), is a monoamine neurotransmitter with a wide range of functions in both the central nervous system (CNS) and also peripheral tissues. It is involved in mood, cognition, reward, learning, memory, and physiological processes such as vomiting and vasoconstriction. In the CNS, serotonin regulates mood, appetite, and sleep. Most of the body's serotonin—about 90%—is synthesized in the gastrointestinal tract by enterochromaffin cells, where it regulates intestinal movements. It is also produced in smaller amounts in the brainstem's raphe nuclei, the skin's Merkel cells, pulmonary neuroendocrine cells, and taste receptor cells of the tongue. Once secreted, serotonin is taken up by platelets in the blood, which release it during clotting to promote vasoconstriction and platelet aggregation. Around 8% of the body's serotonin is stored in platelets, and 1–2% is found in the CNS. Serotonin acts as both a vasoconstrictor and vas ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
