|
Gastrointestinal Hormone
The gastrointestinal hormones (or gut hormones) constitute a group of hormones secreted by enteroendocrine cells in the stomach, pancreas, and small intestine that control various functions of the digestive organs. Later studies showed that most of the gut peptides, such as secretin, cholecystokinin or substance P, were found to play a role of neurotransmitters and neuromodulators in the central and peripheral nervous systems. Enteroendocrine cells do not form glands but are spread throughout the digestive tract. They exert their autocrine and paracrine actions that integrate gastrointestinal function. Types The gastrointestinal hormonesVella A and Drucker DJ (2011)Chapter 39 Gastrointestinal Hormones and Gut Endocrine Tumors, pp 1697-1707. In Williams Textbook of Endocrinology (2011, 12th edition) can be divided into three main groups based upon their chemical structure. * '' Gastrin–cholecystokinin family'': gastrin and cholecystokinin * '' Secretin family'': secretin, gluca ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Hormone
A hormone (from the Ancient Greek, Greek participle , "setting in motion") is a class of cell signaling, signaling molecules in multicellular organisms that are sent to distant organs or tissues by complex biological processes to regulate physiology and behavior. Hormones are required for the normal development of animals, plants and fungi. Due to the broad definition of a hormone (as a signaling molecule that exerts its effects far from its site of production), numerous kinds of molecules can be classified as hormones. Among the substances that can be considered hormones, are eicosanoids (e.g. prostaglandins and thromboxanes), steroids (e.g. Estrogen, oestrogen and brassinosteroid), amino acid derivatives (e.g. epinephrine and auxin), protein or peptides (e.g. insulin and CLE peptides), and gases (e.g. ethylene and nitric oxide). Hormones are used to communicate between organ (anatomy), organs and Tissue (biology), tissues. In vertebrates, hormones are responsible for regulating ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Somatostatin Family
The somatostatin family is a protein family with somatostatin as titular member, a hormone which inhibits the release of the pituitary somatotropin (growth hormone) and inhibits the release of glucagon and insulin from the pancreas of fasted animals. Cortistatin is a cortical neuropeptide with neuronal depressant and sleep-modulating properties. Human proteins from this family * Cortistatin (CORT) * Somatostatin Somatostatin, also known as growth hormone-inhibiting hormone (GHIH) or by #Nomenclature, several other names, is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G ... (SST) References {{InterPro content, IPR004250 Protein domains Hormones ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Bombesin
Bombesin is a 14-amino acid peptide originally isolated from the skin of the European fire-bellied toad (''Bombina bombina'') by Vittorio Erspamer ''et al.'' and named after its source. NIHMSID 45053. It has two known homologs in mammals called neuromedin B and gastrin-releasing peptide. It stimulates gastrin release from G cells. It activates three different G-protein-coupled receptors known as BBR1, -2, and -3. It also activates these receptors in the brain. Together with cholecystokinin, it is the second major source of negative feedback signals that stop eating behaviour. Bombesin is also a tumor marker for small cell carcinoma of lung, gastric cancer, pancreatic cancer, and neuroblastoma. Receptors The anuran receptor homologue is termed (). Iwabuchi ''et al.'' 2003 discovered a chicken The chicken (''Gallus gallus domesticus'') is a domesticated subspecies of the red junglefowl (''Gallus gallus''), originally native to Southeast Asia. It was first do ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Gastric Inhibitory Polypeptide
Gastric inhibitory polypeptide (GIP), also known as glucose-dependent insulinotropic polypeptide, is an inhibiting hormone of the secretin family of hormones. While it is a weak inhibitor of gastric acid secretion, its main role, being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins, which stimulate insulin release on oral food intake. Synthesis and transport GIP is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesized by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. Like all endocrine hormones, it is transported by blood. Gastric inhibitory polypeptide receptors are seven-transmembrane proteins ( GPCRs) found on beta-cells in the pancreas. Functions It has traditionally been named ''gastrointestinal inhibitory peptide ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Vasoactive Intestinal Polypeptide
Vasoactive intestinal peptide, also known as vasoactive intestinal polypeptide or VIP, is a peptide hormone that is vasoactive in the intestine. VIP is a peptide of 28 amino acid residue (chemistry), residues that belongs to a Secretin family, glucagon/secretin superfamily, the ligand (biochemistry), ligand of class II G protein–coupled receptors. VIP is produced in many tissues of vertebrates including the Gut (zoology), gut, pancreas, neocortex, and suprachiasmatic nuclei of the hypothalamus in the brain. VIP stimulates contractility in the heart, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of Vertebrate trachea, trachea, stomach and gallbladder. In humans, the vasoactive intestinal peptide is encoded by the ''VIP'' gene. VIP has a half-life (t½) in the blood of about two minutes. Function In the digestive system In the digestive system, VIP seems to induce smooth muscle relaxation (lower esophageal sphincte ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Secretin
Secretin is a hormone that regulates water homeostasis throughout the body and influences the environment of the duodenum by regulating secretions in the stomach, pancreas, and liver. It is a peptide hormone produced in the S cells of the duodenum, which are located in the intestinal glands. In humans, the secretin peptide is encoded by the ''SCT'' gene. Secretin helps regulate the pH of the duodenum by inhibiting the secretion of gastric acid from the parietal cells of the stomach and stimulating the production of bicarbonate from the ductal cells of the pancreas. It also stimulates the secretion of bicarbonate and water by cholangiocytes in the bile duct, protecting it from bile acids by controlling the pH and promoting the flow in the duct. Meanwhile, in concert with secretin's actions, the other main hormone simultaneously issued by the duodenum, cholecystokinin (CCK), stimulates the gallbladder to contract, delivering its stored bile. Prosecretin is a precursor to secreti ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Big Gastrin
Big gastrin (G-34) is a form of gastrin with 34 amino acids in its sequence. Big gastrin is a hormone produced by G cells and can be found inside of the stomach. G-34 promotes the secretion of gastric acid in dogs. In dogs, the half life of this peptide is between 14.7 and 16.8 minutes. In humans, an over production of this hormone by gastrinomas leads to Zollinger–Ellison syndrome. Responses to foods Big gastrin is one form of gastrin predominate in circulation after a meal, another major form is called little gastrin (G17). Both forms of gastrin have been isolated from human gastrinoma and hog antral mucosa. G34 is carboxy-amidated and can be sulphated or unsulphated at the tyrosine residues. Binding of gastrin to the receptors in stomach can cause the secretion of hydrochloric acids (HCl), the gastric acid. Duodenal ulcer patients tend to have higher than normal basal and maximal rate of gastric acid secretion, while gastric ulcer patients have lower than normal basal a ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Little Gastrin
Little gastrin I is a form of gastrin Gastrin is a peptide hormone that stimulates secretion of gastric acid (HCl) by the parietal cells of the stomach and aids in gastric motility. It is released by G cells in the pyloric antrum of the stomach, duodenum, and the pancreas. ... commonly called as gastrin-17. This is a protein hormone, secreted by the intestine. Gastrin II has identical amino acid composition to Gastrin I, the only difference is that the single tyrosine residue is sulfated in Gastrin II. References Peptide hormones {{biochem-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Cholecystokinin
Cholecystokinin (CCK or CCK-PZ; from Greek ''chole'', "bile"; ''cysto'', "sac"; ''kinin'', "move"; hence, ''move the bile-sac (gallbladder)'') is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein. Cholecystokinin, formerly called pancreozymin, is synthesized and secreted by enteroendocrine cells in the duodenum, the first segment of the small intestine. Its presence causes the release of pancreatic juice from the pancreas and bile from the gallbladder. History Evidence that the small intestine controls the release of bile was uncovered as early as 1856, when French physiologist Claude Bernard showed that when dilute acetic acid was applied to the orifice of the bile duct, the duct released bile into the duodenum. In 1903, the French physiologist showed that this reflex was not mediated by the nervous system. In 1904, the French physiologist Charles Fleig showed that the discharge of bile was mediated by a substance t ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Oxyntomodulin
Oxyntomodulin (often abbreviated OXM) is a naturally occurring 37-amino acid peptide hormone found in the colon, produced by the oxyntic ( fundic) cells of the oxyntic (fundic) mucosa. It has been found to suppress appetite. The mechanism of action of oxyntomodulin is not well understood. It is known to bind both the GLP-1 receptor and the glucagon receptor, but it is not known whether the effects of the hormone are mediated through these receptors or through an unidentified receptor. Oxyntomodulin has been linked to entrainment of the liver's circadian clock. Oxyntomodulin has been investigated as a blood-glucose regulation agent in connection with diabetes Diabetes mellitus, commonly known as diabetes, is a group of common endocrine diseases characterized by sustained high blood sugar levels. Diabetes is due to either the pancreas not producing enough of the hormone insulin, or the cells of th .... Research Oxyntomodulin could be a potential candidate for treatin ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Glucose-dependent Insulinotropic Polypeptide
Gastric inhibitory polypeptide (GIP), also known as glucose-dependent insulinotropic polypeptide, is an inhibiting hormone of the secretin family of hormones. While it is a weak inhibitor of gastric acid secretion, its main role, being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins, which stimulate insulin release on oral food intake. Synthesis and transport GIP is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesized by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. Like all endocrine hormones, it is transported by blood. Gastric inhibitory polypeptide receptors are seven-transmembrane proteins ( GPCRs) found on beta-cells in the pancreas. Functions It has traditionally been named ''gastrointestinal inhibitory peptide'' or ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Amylin
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREP ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
