HOME





EGF Receptor
EGF may refer to: * E.G.F., a Gabonese company * East Grand Forks, Minnesota, a city * East Garforth railway station in England * Epidermal growth factor * Equity Group Foundation, a Kenyan charity * European Gendarmerie Force, a military unit of the European Union * European Genetics Foundation, a training organization * European Globalisation Adjustment Fund * European Go Federation * Exponential generating function In mathematics, a generating function is a way of encoding an infinite sequence of numbers () by treating them as the coefficients of a formal power series. This series is called the generating function of the sequence. Unlike an ordinary ser ... * Xinxiang East railway station, China Railway telegraph code EGF {{disambiguation ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

East Grand Forks, Minnesota
East Grand Forks (also known as EGF) is a city in Polk County, Minnesota, United States. The population was 9,176 at the 2020 Census, making it the largest community in Polk County. It is located in the Red River Valley region along the eastern bank of the Red River of the North, directly across from the larger city of Grand Forks, North Dakota. The cities of Grand Forks and East Grand Forks form the center of the Grand Forks, ND–MN Metropolitan Statistical Area, which is often called Greater Grand Forks. The population was 104,362 at the 2020 Census. History A post office called East Grand Forks has been in operation since 1883. The city was named for its location east of Grand Forks, North Dakota. East Grand Forks was incorporated in 1887. Flood of 1997 East Grand Forks, along with Grand Forks, was heavily damaged by a major flood in 1997. The entire city was under a mandatory evacuation and almost no homes were spared damage. After the flood, several neighborhoods h ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

East Garforth Railway Station
East Garforth railway station serves Garforth in West Yorkshire, England. It lies on the Selby Line, operated by Northern east of Leeds. The station was opened by West Yorkshire Metro on 1 May 1987, to serve the new housing developments in the area. The station is an unstaffed halt, and has wooden platforms with shelters on each one. It is located around from the main Garforth station. Facilities The station is fully accessible for wheelchair users, with ramps from the road to both platforms. Ticket machines are available for passengers to buy or collect pre-paid tickets prior to travel. Train running information is provided by a long line P.A system and digital display screens on each platform. Services Monday to Saturday daytime there is a half-hourly service to Leeds, with alternate services continuing to Bradford Interchange Bradford Interchange is a transport interchange in Bradford, West Yorkshire, England, which consists of a railway station and combined ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Epidermal Growth Factor
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-k Da and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone. Structure In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). Function EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival. Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the m ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Equity Group Foundation
Equity Group Foundation (EGF) is an East African foundation based in Nairobi, Kenya. It was founded in 2008 to bolster Corporate social responsibility (CSR) for the Equity Group. Overview The main aim of Equity Group Foundation is to enhance the social and economic prosperity of people in the African region. This is through creating opportunities for people living at the bottom of the pyramid thus incorporating them into the modern economy. Since its inception in 2008, the Foundation has significantly enhanced the coordination of corporate social responsibility (CSR) interventions for Equity Group Holdings Limited. Through their ''Wings to Fly'' Program, Equity Group Foundation has been able to fund 28,009 students since inception. This program is co-funded by the Mastercard Foundation to the tune of US$100 million. The ''Harvard Business Review'' described the foundation as being focused on driving African development and creating opportunities for prosperity. Focus areas ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

European Gendarmerie Force
The European Gendarmerie Force (EUROGENDFOR) is an operational, pre-organised, and rapidly deployable intervention force, exclusively comprising elements of several European police forces with military status of the Parties in order to perform all police tasks within the scope of crisis management operations, as established by Art.1 of the Treaty establishing the European Gendarmerie Force. It was launched by an agreement in 2006 between five member states of the European Union (EU): France, Italy, the Netherlands, Portugal, and Spain. Romania joined in 2009; Poland in 2011. Its status is enshrined in the Treaty of Velsen of 18 October 2007.Eurogendfor.orgTreaty establishing the European Gendarmerie Force, accessed on January 24, 2014 The headquarters are located in Vicenza, Italy. It is presently not established at the EU level (referred to as the Common Security and Defence Policy, CSDP); it is for instance not a project of the Permanent Structured Cooperation (PESCO) of the CS ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


European Genetics Foundation
The European Genetics Foundation (EGF) is a non-profit organization, dedicated to the training of young geneticists active in medicine, to continuing education in genetics/genomics and to the promotion of public understanding of genetics. Its main office is located in Bologna, Italy. Background In 1988 Prof. Giovanni Romeo, President of the European Genetics Foundation (EGF) and professor of Medical Genetics at the University of Bologna and Prof. Victor A. McKusick founded together the European School of Genetic Medicine (ESGM). Since that time ESGM has taught genetics to postgraduate students (young M.D. and PhD) from some 70 different countries. Most of the courses are presented at ESGM's Main Training Center (MTC) in Bertinoro di Romagna (Italy), and are also available via webcast at authorized Remote Training Centers (RTC) in various countries in Europe and the Mediterranean area (Hybrid Courses). In the Netherlands and Switzerland, medical geneticists must attend at least o ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


European Globalisation Adjustment Fund
The European Globalisation Adjustment Fund for Displaced Workers (EGF) was set up by the European Union in late 2006 to support to workers (not companies or institutions) who have been made redundant as a result of trade liberalisation, so that they can either remain in employment or find a new job quickly. It provides counselling; job search and mobility allowances; new ICT skills and other forms of training; entrepreneurial support, including micro-credits. Since 2007 EGF has received more than 100 applications from 20 EU member states for programs that would support more than 100,000 workers who either lost their jobs due to globalization (56%) or as a result of the global economic and financial crisis (44%). The hardest-hit industries were in automobile manufacturing (22.5%), machinery and equipment (13.5%), textile and apparel (12%), computers, mobile phones and ICT (11.6%) and construction (9.6%). Conditions for assistance The Fund is activated upon request of a member s ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




European Go Federation
The European Go Federation (EGF) is a non-profit organization with the purpose of encouraging, regulating, co-ordinating, and disseminating the playing of the board game Go in Europe. The EGF was founded in 1957, the same year that the inaugural European Go Congress (EGC) took place in Cuxhaven, Germany. The Congress has been an annual event every year since then, held each time in a different European city. The European Go Championship takes place during the EGC, as well as the Annual General Meeting (AGM). In 2014, the European Professional System was established by the European Go Federation. Membership is open to any Go-organising association in a country in or near Europe. There are currently 35 full members, and two suspended members. Function The EGF elects an Executive Committee which supervises a number of commissions in charge of normal activities in between the AGMs. Major European tournaments do not fall under the Executive Committee's supervision, but are direc ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Exponential Generating Function
In mathematics, a generating function is a way of encoding an infinite sequence of numbers () by treating them as the coefficients of a formal power series. This series is called the generating function of the sequence. Unlike an ordinary series, the ''formal'' power series is not required to converge: in fact, the generating function is not actually regarded as a function, and the "variable" remains an indeterminate. Generating functions were first introduced by Abraham de Moivre in 1730, in order to solve the general linear recurrence problem. One can generalize to formal power series in more than one indeterminate, to encode information about infinite multi-dimensional arrays of numbers. There are various types of generating functions, including ordinary generating functions, exponential generating functions, Lambert series, Bell series, and Dirichlet series; definitions and examples are given below. Every sequence in principle has a generating function of each type (exce ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]