Cecropia Moth
''Hyalophora cecropia'', the cecropia moth, is North America's largest native moth. It is a member of the family Saturniidae, or giant silk moths. Females have been documented with a wingspan of or more. These moths can be found predominately across the east of North America, with occurrences as far west as Washington and north into the majority of Canadian provinces. Cecropia moth larvae are most commonly found on maple trees, but they have also been found on cherry and birch trees among many others. The species was first described by Carl Linnaeus in his 1758 10th edition of ''Systema Naturae''. Life cycle Like other members of the giant silk moth family, the adult cecropia moth lacks functional mouth parts and a digestive system. Due to this, they survive approximately two weeks. To find a mate, the female cecropia moth emits pheromones which the male detects with its sensitive antennae. Male cecropia moths can detect these pheromones from up to a mile away, although a ma ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Carl Linnaeus
Carl Linnaeus (23 May 1707 – 10 January 1778), also known after ennoblement in 1761 as Carl von Linné,#Blunt, Blunt (2004), p. 171. was a Swedish biologist and physician who formalised binomial nomenclature, the modern system of naming organisms. He is known as the "father of modern Taxonomy (biology), taxonomy". Many of his writings were in Latin; his name is rendered in Latin as and, after his 1761 ennoblement, as . Linnaeus was the son of a curate and was born in Råshult, in the countryside of Småland, southern Sweden. He received most of his higher education at Uppsala University and began giving lectures in botany there in 1730. He lived abroad between 1735 and 1738, where he studied and also published the first edition of his ' in the Netherlands. He then returned to Sweden where he became professor of medicine and botany at Uppsala. In the 1740s, he was sent on several journeys through Sweden to find and classify plants and animals. In the 1750s and 1760s, he co ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Squirrel
Squirrels are members of the family Sciuridae (), a family that includes small or medium-sized rodents. The squirrel family includes tree squirrels, ground squirrels (including chipmunks and prairie dogs, among others), and flying squirrels. Squirrels are indigenous to the Americas, Eurasia, and Africa, and were introduced by humans to Australia. The earliest known fossilized squirrels date from the Eocene epoch, and among other living rodent families, the squirrels are most closely related to the mountain beaver and dormice. Etymology The word ''squirrel'', first attested in 1327, comes from the Anglo-Norman which is from the Old French , the reflex of a Latin language">Latin word , which was taken from the Ancient Greek word (; from ) 'shadow-tailed', referring to the long bushy tail which many of its members have. ''Sciurus'' is also the name of one of its genuses. The native Old English language, Old English word for the squirrel, , only survived into Middle Eng ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Eclosion
A pupa (; : pupae) is the life stage of some insects undergoing transformation between immature and mature stages. Insects that go through a pupal stage are holometabolous: they go through four distinct stages in their life cycle, the stages thereof being egg, larva, pupa, and imago. The processes of entering and completing the pupal stage are controlled by the insect's hormones, especially juvenile hormone, prothoracicotropic hormone, and ecdysone. The act of becoming a pupa is called pupation, and the act of emerging from the pupal case is called eclosion or emergence. The pupae of different groups of insects have different names such as ''chrysalis'' for the pupae of butterflies and ''tumbler'' for those of the mosquito family. Pupae may further be enclosed in other structures such as cocoons, nests, or shells. Position in life cycle The pupal stage follows the larval stage, or in some cases a prepupal stage, and precedes adulthood ('' imago'') in insects with compl ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Entomological Equipment For Mounting And Storage
Insect collecting refers to the collection of insects and other arthropods for scientific study or as a hobby.Manoj K., Ranjan R., Sinha M. P., Dhan A., Naaz F., Khanum G., Rani K. A., Sharma S., Raipat B. S. (2022). A Review on Insect Collection and Preservation Techniques. European Journal of Pharmaceutical and Medical Research, 9(7): 233-239. Most insects are small and the majority cannot be identified without the examination of minute morphological characters, so entomologists often make and maintain insect collections. Very large collections are preserved in natural history museums or University, universities where they are maintained and studied by specialists. Many college courses require students to form small collections. There are also amateur entomologists and collectors who keep collections. Historically, insect collecting has been widespread and was in the Victorian age a very popular educational hobby. Insect collecting has left traces in European cultural history, ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Agriculture And Agri-Food Canada
Agriculture and Agri-Food Canada (AAFC; sometimes Ag-Canada; )''Agriculture and Agri-Food Canada'' is the applied title under the Federal Identity Program; the legal title is Department of Agriculture and Agri-Food (). is the Structure of the Canadian federal government, department of the Government of Canada responsible for the federal regulation of agriculture, including policies governing the production, processing, and marketing of all farm, food, and agri-based products. Agriculture in Canada is a shared jurisdiction and the department works with the Provinces and territories of Canada, provinces and territories in the development and delivery of policies and programs. The Minister of Agriculture (Canada), minister of agriculture and agri-food (currently Kody Blois) is Responsible government, responsible for the department to Parliament of Canada, Parliament. While the minister is head of the department, and provides policy/political direction, the day-to-day operations of th ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Cornus (genus)
''Cornus'' is a genus of about 30–60 species of woody plants in the family Cornaceae, commonly known as dogwoods or cornels, which can generally be distinguished by their blossoms, berries, and distinctive bark. Most are deciduous trees or shrubs, but a few species are nearly herbaceous perennial subshrubs, and some species are evergreen. Several species have small heads of inconspicuous flowers surrounded by an involucre of large, typically white petal-like bracts, while others have more open clusters of petal-bearing flowers. The various species of dogwood are native throughout much of temperate and boreal Eurasia and North America, with China, Japan, and the southeastern United States being particularly rich in native species. Species include the common dogwood '' Cornus sanguinea'' of Eurasia, the widely cultivated flowering dogwood ''(Cornus florida)'' of eastern North America, the Pacific dogwood '' Cornus nuttallii'' of western North America, the Kousa d ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Ontario
Ontario is the southernmost Provinces and territories of Canada, province of Canada. Located in Central Canada, Ontario is the Population of Canada by province and territory, country's most populous province. As of the 2021 Canadian census, it is home to 38.5% of the country's population, and is the second-largest province by total area (after Quebec). Ontario is Canada's fourth-largest jurisdiction in total area of all the Canadian provinces and territories. It is home to the nation's capital, Ottawa, and its list of the largest municipalities in Canada by population, most populous city, Toronto, which is Ontario's provincial capital. Ontario is bordered by the province of Manitoba to the west, Hudson Bay and James Bay to the north, and Quebec to the east and northeast. To the south, it is bordered by the U.S. states of (from west to east) Minnesota, Michigan, Ohio, Pennsylvania, and New York (state), New York. Almost all of Ontario's border with the United States follows riv ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Humoral Immunity
Humoral immunity is the aspect of immunity (medical), immunity that is mediated by macromolecules – including secreted antibodies, complement proteins, and certain antimicrobial peptides – located in extracellular fluids. Humoral immunity is named so because it involves substances found in the humorism, humors, or body fluids. It contrasts with cell-mediated immunity. Humoral immunity is also referred to as antibody-mediated immunity. The study of the molecular and cellular immunity, cellular components that form the immune system, including their function and interaction, is the central science of immunology. The immune system is divided into a more primitive innate immune system and an acquired or adaptive immune system of vertebrates, each of which contain both humoral and cell (biology), cellular immune elements. Humoral immunity refers to antibody production and the coinciding processes that accompany it, including: Th2 activation and cytokine production, germinal center ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Protein
Proteins are large biomolecules and macromolecules that comprise one or more long chains of amino acid residue (biochemistry), residues. Proteins perform a vast array of functions within organisms, including Enzyme catalysis, catalysing metabolic reactions, DNA replication, Cell signaling, responding to stimuli, providing Cytoskeleton, structure to cells and Fibrous protein, organisms, and Intracellular transport, transporting molecules from one location to another. Proteins differ from one another primarily in their sequence of amino acids, which is dictated by the Nucleic acid sequence, nucleotide sequence of their genes, and which usually results in protein folding into a specific Protein structure, 3D structure that determines its activity. A linear chain of amino acid residues is called a polypeptide. A protein contains at least one long polypeptide. Short polypeptides, containing less than 20–30 residues, are rarely considered to be proteins and are commonly called pep ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Cecropin
Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of '' Hyalophora cecropia'', whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. Cecropins constitute a main part of the innate immune system of insects. Cecropins are small proteins anywhere from 31 - 37 amino acids long and are active against both gram-positive and gram-negative bacteria. Cecropins isolated from insects other than '' Hyalophora cecropia'' (Cecropia moth) have been given various names, such as bactericidin, , and sarcotoxin. All of these peptides are structurally related. Members Members include: ;Cecropin A: Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. ;Cecropin B: Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondar ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Nature (journal)
''Nature'' is a British weekly scientific journal founded and based in London, England. As a multidisciplinary publication, ''Nature'' features Peer review, peer-reviewed research from a variety of academic disciplines, mainly in science and technology. It has core editorial offices across the United States, continental Europe, and Asia under the international scientific publishing company Springer Nature. ''Nature'' was one of the world's most cited scientific journals by the Science Edition of the 2022 ''Journal Citation Reports'' (with an ascribed impact factor of 50.5), making it one of the world's most-read and most prestigious academic journals. , it claimed an online readership of about three million unique readers per month. Founded in the autumn of 1869, ''Nature'' was first circulated by Norman Lockyer and Alexander MacMillan (publisher), Alexander MacMillan as a public forum for scientific innovations. The mid-20th century facilitated an editorial expansion for the j ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Carroll Williams
Carroll Milton Williams (December 2, 1916 in Oregon Hill, Virginia October 11, 1991 in Watertown, Massachusetts) was an American zoologist known for his work in entomology and developmental biology—in particular, metamorphosis in insects, for which he won the George Ledlie Prize. He performed groundbreaking surgical experiments on larvae and pupae, and developed multiple new techniques, including the use of carbon dioxide as an anesthetic. His impact on entomology has been compared to that of Vincent Wigglesworth. Education Williams was educated at the University of Richmond and Harvard University, where he was awarded a Ph.D. in zoology in 1941. Elected to the Harvard Society of Fellows, he also earned a M.D., ''summa cum laude''. Career and research For his thesis he studied the wingbeat frequency of ''Drosophila'', using a stroboscopic device which he designed with the advice of Harold Edgerton. In 1942, he began a series of experiments on metamorphosis. In the ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |